Powered by FoodRisk.org

Allergen

AAD42942.1

Accession AAD42942.1
Species Sesamum indicum
Common Name Sesame
Description 15 kDa oleosin [Sesamum indicum]
Gi 0005381321
Length 145
Year Adopted 2015
Sequence >accession|AAD42942.1|Putative 15 kDa oleosin [Sesamum indicum]
MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL
VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL
ASKAREMKDRAEQFSQQPVAGSQTS