Powered by FoodRisk.org

Allergen

AAD42943.1

Accession AAD42943.1
Species Sesamum indicum
Common Name Sesame
Description 2S albumin precursor [Sesamum indicum]
Gi 0005381323
Length 148
Year Adopted 2007
Sequence >accession|AAD42943.1|Putative 2S albumin precursor [Sesamum indicum]
MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMRS
MRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQ
QMQQMMQYLPRMCGMSYPTECRMRPIFA