Powered by FoodRisk.org

Allergen

AAD42944.1

Accession AAD42944.1
Species Sesamum indicum
Common Name Sesame
Description 11S globulin precursor [Sesamum indicum]
Gi 0005381325
Length 459
Year Adopted 2015
Sequence >accession|AAD42944.1|Allergen 11S globulin precursor [Sesamum indicum]
MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE
RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ
RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN
HLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ
SEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADI
FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQV
VDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIR
AMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS