Powered by FoodRisk.org

Allergen

AAD55792.2

Accession AAD55792.2
Species Mesocricetus auratus
Common Name Golden hamster
Description male-specific submandibular protein MSP precursor [Mesocricetus auratus]
Gi 0013124669
Length 172
Year Adopted 2016
Sequence >accession|AAD55792.2|Putative male-specific submandibular protein MSP precursor [Mesocricetus auratus]
MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC
SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN
VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ