Allergen

AAF35431.1

Accession AAF35431.1
Species Charybdis feriata
Common Name Crab
Description tropomyosin
IUIS Name Cha f 1
Gi 0007024506
Length 264
Year Adopted 2007
Sequence >AAF35431.1 Allergen Cha f 1; tropomyosin [Charybdis feriata]
MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA
QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEK
Parent Accession