Powered by FoodRisk.org

Allergen

AAG08987.1

Accession AAG08987.1
Species Haliotis diversicolor
Common Name Abalone
Description tropomyosin [Haliotis diversicolor]
IUIS Name
Gi 0009954249
Length 284
Year Adopted 2007
Sequence >AAG08987.1 Putative tropomyosin [Haliotis diversicolor]
MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV
NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA
DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE
ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT
EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY
Parent Accession