Allergen

AAG23840.1

Accession AAG23840.1
External DB Link NCBI Protein
Species Sesamum indicum
Common Name sesame
Description oleosin
IUIS Name Ses i 4
Length 166
Year Adopted 2013
Sequence >AAG23840.1 Ses i 4; oleosin [Sesamum indicum]
MADRDRPHPHQIQVHPQHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT
LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRA
TGQGPLEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART
Parent Accession

Related Articles

Pubmed Authors Title Journal
16436145 Leduc V; Moneret-Vautrin DA; Tzen JT; Morisset M; Guerin L; Kanny G Identification of oleosins as major allergens in sesame seed allergic patients. Allergy. 2006 Mar;61(3):349-56
12450125 Tai,S.S.; Chen,M.C.; Peng,C.C.; Tzen,J.T.; Gene family of oleosin isoforms and their structural stabilization in sesame seed oil bodies Biosci. Biotechnol. Biochem. 66 (10), 2146-2153 (2002)
12190661 Fremont S; Zitouni N; Kanny G; Veneri V; Metche M; Moneret-Vautrin DA; Nicolas JP Allergenicity of some isoforms of white sesame proteins. Clin Exp Allergy. 2002 Aug;32(8):1211-5