Powered by FoodRisk.org

Allergen

AAK15087.1

Accession AAK15087.1
Species Sesamum indicum
Common Name Sesame
Description 11S globulin [Sesamum indicum]
Gi 0013183173
Length 497
Year Adopted 2015
Sequence >accession|AAK15087.1|Putative 11S globulin [Sesamum indicum]
MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCRVERLTAQEPT
IRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQLLYVVRGRGIQGT
VIPGCAETFERDTQPRQDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITV
ALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADA
FGVDVQTARRLKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCTAKL
RENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSI
IYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNA
MTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMS
YMPKPFEYVLDVIKSMM