Powered by FoodRisk.org

Allergen

AAK15088.1

Accession AAK15088.1
Species Sesamum indicum
Common Name Sesame
Description 2S albumin [Sesamum indicum]
Gi 0013183175
Length 153
Year Adopted 2007
Sequence >accession|AAK15088.1|Putative 2S albumin [Sesamum indicum]
MAKKLALAAVLLVAMVALASATTYTTTVTTTAIDDEANQQSQQCRQQLQGRQFRSCQRYL
SQGRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLRNVDERCRCEAIRQAVRQQQQEGGY
QEGQSQQVYQRARDLPRRCNMRPQQCQFRVIFV