Allergen

AAK56124.1

Accession AAK56124.1
Species Zea mays
Common Name Corn
Description beta-expansin 1 [Zea mays]
IUIS Name
Gi 0014193761
Length 269
Year Adopted 2008
Sequence >AAK56124.1 Putative beta-expansin 1 [Zea mays]
MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP
DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM
NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC
NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS
ESGKKVIAKDVIPANWRPDAVYTSNVQFY
Parent Accession