Powered by FoodRisk.org

Allergen

AAK63089.1

Accession AAK63089.1
Species Theragra chalcogramma
Common Name Alaska pollock
Description parvalbumin [Theragra chalcogramma]
IUIS Name
Gi 0014531020
Length 109
Year Adopted 2007
Sequence >AAK63089.1 Allergen parvalbumin [Theragra chalcogramma]
MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE
EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA
Parent Accession