Powered by FoodRisk.org

Allergen

AAL25839.1

Accession AAL25839.1
Species Hevea brasiliensis
Common Name Para rubber tree
Description lipid transfer protein (LTP) type 1
IUIS Name Hev b 12
Gi 0020135538
Length 116
Year Adopted 2007
Sequence >AAL25839.1 Allergen Hev b 12; lipid transfer protein (LTP) type 1 [Hevea brasiliensis]
MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTIN
NAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK
Parent Accession