Powered by FoodRisk.org

Allergen

AAL73404.1

Accession AAL73404.1
Species Corylus avellana
Common Name European hazelnut
Description 11S globulin-like protein [Corylus avellana]
Gi 0018479082
Length 515
Year Adopted 2007
Sequence >accession|AAL73404.1|Allergen 11S globulin-like protein [Corylus avellana]
MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE
SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED
PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL
HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV
FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER
ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP
VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ
VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE
ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA