Powered by FoodRisk.org

Allergen

AAL91662.1

Accession AAL91662.1
Species Prunus dulcis
Common Name Almond
Description profilin
IUIS Name Pru du 4
Gi 0024473794
Length 131
Year Adopted 2007
Sequence >AAL91662.1 Allergen Pru du 4; profilin [Prunus dulcis]
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL
APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE
RLGDYLIEQGL
Parent Accession