Powered by FoodRisk.org

Allergen

AAL91665.1

Accession AAL91665.1
Species Anacardium occidentale
Common Name Cashew
Description 2s albumin [Anacardium occidentale]
Gi 0024473800
Length 138
Year Adopted 2007
Sequence >accession|AAL91665.1|Putative 2s albumin [Anacardium occidentale]
MAKFLLLLSAFAVLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEV
QRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASEL
PRICSISPSQGCQFQSSY