Allergen

AAL91665.1

Accession AAL91665.1
Species Anacardium occidentale
Common Name Cashew
Description 2S albumin
IUIS Name Ana o 3
Gi 0024473800
Length 138
Year Adopted 2007
Sequence >AAL91665.1 Allergen Ana o 3; 2S albumin [Anacardium occidentale]
MAKFLLLLSAFAVLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEV
QRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASEL
PRICSISPSQGCQFQSSY
Parent Accession