Powered by FoodRisk.org

Allergen

AAM54365.1

Accession AAM54365.1
Species Juglans nigra
Common Name Black walnut
Description 2S albumin seed storage protein [Juglans nigra]
Gi 0031321942
Length 161
Year Adopted 2007
Sequence >accession|AAM54365.1|Putative 2S albumin seed storage protein [Juglans nigra]
RHEARKCIFHTFSLTMARLATLAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEG
CQEQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQIEEQCQCEGLRQAVR
RQQQQQGLRGEEMEEMVQSARDLPKECGISSQRCEIRRSWF