Powered by FoodRisk.org

Allergen

AAM54365.1

Accession AAM54365.1
Species Juglans nigra
Common Name Black walnut
Description 2S albumin
IUIS Name Jug n 1
Gi 0031321942
Length 161
Year Adopted 2007
Sequence >AAM54365.1 Allergen Jug n 1; 2S albumin [Juglans nigra]
RHEARKCIFHTFSLTMARLATLAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEG
CQEQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQIEEQCQCEGLRQAVR
RQQQQQGLRGEEMEEMVQSARDLPKECGISSQRCEIRRSWF
Parent Accession