Allergen

AAM77471.1

Accession AAM77471.1
Species Alternaria alternata
Common Name Fungus
Description major allergen alt a1 [Alternaria alternata]
IUIS Name
Gi 0021913174
Length 115
Year Adopted 2007
Sequence >AAM77471.1 Allergen major allergen alt a1 [Alternaria alternata]
MQFTTIASLFAAAGLAAAAPLESRQDNASCPVTTKGDYVWKISEFYGRKPEGTYYNSLGF
NIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDE
Parent Accession