Allergen

AAM83103.1

Accession AAM83103.1
Species Blomia tropicalis
Common Name Mite
Description paramyosin
IUIS Name Blo t 11
Gi 0021954740
Length 875
Year Adopted 2007
Sequence >AAM83103.1 Allergen Blo t 11; paramyosin [Blomia tropicalis]
MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK
SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH
QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV
HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR
HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE
AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT
AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE
ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA
KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK
KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ
RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS
ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI
RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE
EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES
NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF
Parent Accession