Powered by FoodRisk.org

Allergen

AAN11300.1

Accession AAN11300.1
Species Candida albicans
Common Name Yeast
Description 29 kDa IgE-binging protein [Candida albicans]
Gi 0037548637
Length 236
Year Adopted 2007
Sequence >accession|AAN11300.1|Putative 29 kDa IgE-binging protein [Candida albicans]
MVKVLLALTSYNETFYSDGKKTGVFVVEALHPFEVFRKKGYEIQLASETGTFGWDDHSVV
PDFLNGEDKEIFDNVNSEFNVALKNLKKASDLDPNDYDIFFGSAGHGTLFDYPHAKDLQK
IATTVYNKGGVVSAVCHGPAIFENLNDPKTGEPLIKGKKITGFTDIGEDILGVTDIMKKG
NLLTIKQVAEKEGATYIEPEGPWDNFTVTDGRIVTGVNPQSAVKTAEDVIAAFECN