Allergen

AAN76862.1

Accession AAN76862.1
Species Anacardium occidentale
Common Name Cashew
Description 11S globulin, glycinin, cupin
IUIS Name Ana o 2
Gi 0025991543
Length 457
Year Adopted 2007
Sequence >AAN76862.1 Allergen Ana o 2; 11S globulin, glycinin, cupin [Anacardium occidentale]
LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG
VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF
QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG
NPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELR
VIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN
RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV
LANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
Parent Accession