Allergen

AAO25113.1

Accession AAO25113.1
Species Malus domestica
Common Name Apple
Description pathogenesis related protein, PR-10, Bet v 1-like protein
IUIS Name Mal d 1
Gi 0027922941
Length 159
Year Adopted 2007
Sequence >AAO25113.1 Allergen Mal d 1; pathogenesis related protein, PR-10, Bet v 1-like protein [Malus domestica]
MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN
Parent Accession