Allergen

AAO32314.1

Accession AAO32314.1
Species Carya illinoinensis
Common Name Pecan
Description 2S albumin
IUIS Name Car i 1
Gi 0028207731
Length 143
Year Adopted 2007
Sequence >AAO32314.1 Allergen Car i 1; 2S albumin [Carya illinoinensis]
MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQYLNRCQDYL
RQQCRSGGYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQ
CASDLPKECGISSRSCEIRRSWF
Parent Accession