Powered by FoodRisk.org

Allergen

AAO38859.1

Accession AAO38859.1
Species Bertholletia excelsa
Common Name Brazil nut
Description 11S globulin [Bertholletia excelsa]
Gi 0030313867
Length 465
Year Adopted 2007
Sequence >accession|AAO38859.1|Putative 11S globulin [Bertholletia excelsa]
MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ
QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS
REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD
QNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARK
VRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEA
DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV
QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP
LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA