Allergen

AAO45608.1

Accession AAO45608.1
Species Zea mays
Common Name Corn
Description beta-expansin 1 protein [Zea mays]
IUIS Name
Gi 0028630923
Length 269
Year Adopted 2007
Sequence >AAO45608.1 Putative beta-expansin 1 protein [Zea mays]
MGSLANNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP
DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM
NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC
NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS
ESGKKVIAKDVIPANWRPDAVYTSNVQFY
Parent Accession