Allergen

AAO73464.1

Accession AAO73464.1
Species Dermatophagoides pteronyssinus
Common Name House dust mite
Description paramyosin
IUIS Name Der p 11
Gi 0037778944
Length 875
Year Adopted 2007
Sequence >AAO73464.1 Allergen Der p 11; paramyosin [Dermatophagoides pteronyssinus]
MSARTAKYMYRSSGAGASGDISVEYGTDLGALTRLEDKIRLLSDDLESEREMRQRIEREK
AELQIQVMSLSERLEEAEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH
QAAVHEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLSQLETANKEKLTALKSVEKLEYTV
HELNIKIEEINRTVIELTSHKQRLTQENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTR
HRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEARLELERQLTKANGDAASWKSKYE
AELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAA
AHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRD
QLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQEEA
KNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLK
KKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQ
RRCQALQAELEEMRIALEQASRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFS
ALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHV
RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE
EDHKQIQLLQEMTDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES
NLSFIRAKHRSWVTTSQVPGGTRQVFTTQEETTNY
Parent Accession