Powered by FoodRisk.org

Allergen

AAP35068.1

Accession AAP35068.1
Species Dermatophagoides farinae
Common Name American House Dust Mite
Description Putative Der f 5
Gi
Length 132
Year Adopted 2019
Sequence >accession|AAP35068.1|Putative Der f 5 [Dermatophagoides farinae]
MKFIIAIAVCTLAVVCVSGEPKKHDYQNEFDFLLMQRIHDQMRKGEEALLHLHQINTFEE
NPTKEMKEQILASEMDTIIALIDGVRGVLNRLMKRTDLDIFERYNVEIALKSNEILERDL
KKEEQRVKKIEV