Allergen

AAP47226.1

Accession AAP47226.1
External DB Link NCBI Protein
Species Helianthus annuus
Common Name sunflower
Description lipid transfer protein
IUIS Name Hel a 3
Length 116
Year Adopted 2015
Sequence >AAP47226.1 Hel a 3; lipid transfer protein [Helianthus annuus]
MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKL
LGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGISTSIPINPNVNCNTIP
Parent Accession

Related Articles

Pubmed Authors Title Journal
20384612 Yagami A Anaphylaxis to lipid transfer protein from sunflower seeds. Allergy. 2010 Oct;65(10):1340-1
12685036 Regente M; de la Canal L A cDNA encoding a putative lipid transfer protein expressed in sunflower seeds. J Plant Physiol. 2003 Feb;160(2):201-3
N/A: See Journal Luckett S; Sessions R; Michaelson L; Naldrett M; Clarke A; Fido R; Tatham A; Shewry P Amino acid sequence and molecular modelling of a lipid transfer protein from sunflower (Helianthus annus L) seeds Protein and Peptide Letters (2001) 8(4):241-248