Powered by FoodRisk.org

Allergen

AAU43733

Accession AAU43733
Species Citrullus lanatus
Common Name Watermelon
Description Profilin
Gi
Length 131
Year Adopted 2018
Sequence >accession|AAU43733.1|Profilin [Citrullus lanatus]
MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL
APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE
RLGDYLIEQGL