Powered by FoodRisk.org

Allergen

AAV33670.1

Accession AAV33670.1
Species Morus bombycis
Common Name Mulberry
Description 18 kD winter accumulating protein A [Morus bombycis]
Gi 0054311115
Length 157
Year Adopted 2012
Sequence >accession|AAV33670.1|Putative 18 kD winter accumulating protein A [Morus bombycis]
MGVFTFDDEFTSTVAPARFFKAAVLDADNLFPKVAPQAAKSAETVEGNGGPGTVKKITLP
DGKYVKQRLDSIDHDNFTYGHSIIEGDVLSADIEKISHVTKFVASPSGGSIIKVTTTFHT
VGDAPVDEAKAKEGKEKAEGLFKLVEGYLEANPSAYN