Powered by FoodRisk.org

COMPARE Database

AAV39514.1

Accession AAV39514.1
Species Triticum aestivum
Common Name Bread Wheat
Description 0.19 family dimeric alpha-amylase inhibitor
Gi
Length 124
Year Adopted 2019
Sequence >accession|AAV39514.1|0.19 family dimeric alpha-amylase inhibitor [Triticum aestivum]
SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSM
LDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA
YPDA
Notes This record (Accession# AAV39514.1) replaces Accession# CAI84642.1 in previous versions of COMPARE; which were imported from AOL v.16 when building the first version of COMPARE