Powered by FoodRisk.org

Allergen

AAW29810.1

Accession AAW29810.1
Species Juglans regia
Common Name English walnut
Description 11S globulin/legumin- like protein
IUIS Name Jug r 4
Gi 0056788031
Length 507
Year Adopted 2007
Sequence >AAW29810.1 Allergen Jug r 4; 11S globulin/legumin- like protein [Juglans regia]
MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESW
DPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEESQ
RQSQQGQSREFQQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQ
LDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDAD
FLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERES
ESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRWL
QLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIP
QNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLK
FNRQESTLVRSRPSRSRSSRSERRAEV
Parent Accession