Powered by FoodRisk.org

Allergen

AAX34057.1

Accession AAX34057.1
Species Tyrophagus putrescentiae
Common Name Mould Mite
Description Putative Tyr p 5
Gi
Length 135
Year Adopted 2019
Sequence >accession|AAX34057.1|Putative Tyr p 5 [Tyrophagus putrescentiae]
MKFAILALAFLGAVMAQGGPKVPAKGDFRNEFDHLLVSTLMEGMYKGEQHLLRLSEEIAH
LESTKTKVEQDRIVREIEVTVAFIEGGVRVVEQELKRTDLNILERFNFEEVQALSKLLVK
DLKEAEVKVKAVKTR