Powered by FoodRisk.org

Allergen

AAX34059.1

Accession AAX34059.1
Species Tyrophagus putrescentiae
Common Name Mould Mite
Description Putative Tyr p 21
Gi
Length 138
Year Adopted 2019
Sequence >accession|AAX34059.1|Putative Tyr p 21 [Tyrophagus putrescentiae]
MKFVIALAALLAVACAAPTPKPARPTPAKGDFRNEFDHLIVAAAVQRFHDLEEFLLKLSE
QVADLEKTKNREEKAKILREITIADGLVVGGRTYFEKELKRTDLDLVEKFNFEAVLATIG
ILDRDLKALATRVNAIKV