Powered by FoodRisk.org

Allergen

AAX35807.1

Accession AAX35807.1
Species Lens culinaris
Common Name Lentil
Description lipid transfer protein (LTP) type 1
IUIS Name Len c 3
Gi 0060735410
Length 118
Year Adopted 2015
Sequence >AAX35807.1 Allergen Len c 3; lipid transfer protein (LTP) type 1 [Lens culinaris]
MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL
LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
Parent Accession