Allergen

AAX40948.1

Accession AAX40948.1
Species Ziziphus mauritiana
Common Name Chinese-date
Description chitinase
IUIS Name Ziz m 1
Gi 0061225281
Length 330
Year Adopted 2007
Sequence >AAX40948.1 Allergen Ziz m 1; chitinase [Ziziphus mauritiana]
MVPQAKLVVASLILTSALIQTSEAVGGIATYWGQYTETEEGSLAEACASNLYSYINIAYL
NIFGEGRYLSLNISGHCSDCTFLGEEIKACQSQGVKIFLSLGGPYGDYHLTTDGDADRVA
EQLWSSFLGGSKSTGVYQPLLGDVELDGIDLDIQIGPPEEYDVLARNLKDLTKDRTRPFY
LSAAPKCSAYNDSDAYLWTAVETGLFDFVWVKFYNDTSCQYNNDTAAGLDAFYRSWYDWT
VSLAEGNKLLIGIPASNETDNSPLGGYIPSDVLNDQIVSVIMTSSKFGGVNVWNRYYDLK
TNYSSSIILEYVNSGTKYLPLRTKFMYQNA
Parent Accession