Powered by FoodRisk.org

Allergen

AAX77383.1

Accession AAX77383.1
Species Sinapis alba
Common Name White mustard
Description 11S globulin precursor [Sinapis alba]
Gi 0062240390
Length 510
Year Adopted 2007
Sequence >accession|AAX77383.1|Allergen 11S globulin precursor [Sinapis alba]
MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEY
WDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDS
QPMQGQQGQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQK
VEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGS
SQQQQQQQQNILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVRPPLRQ
AYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLP
ILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQ
LVVIPQGFAYVVQSQNNFEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEA
RKIKFNTLETTLTRARGGQQPQLIEEIVEV