Allergen

AAX77384.1

Accession AAX77384.1
Species Sinapis alba
Common Name White mustard
Description 11S globulin precursor [Sinapis alba]
IUIS Name Sin a 2
Gi 0062240392
Length 523
Year Adopted 2007
Sequence >AAX77384.1 Allergen Sin a 2; 11S globulin precursor [Sinapis alba]
MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTETIKSEAGRLEY
WDHNNPQIRCAGVSIARLVIEQGGFYLPTFFSSPKISYVVQGMGISGRVIPGCAETFMDS
QPMQGQQQGHQGQQQGQQGQQGQQGQQGQQGQQQGQQGQQGQQGQQGQQGQQGQQGQQQQ
GQQGFRDMYQKVEHVRHGDVIANTPGSAHWIYNTGDKPLVIISLLDIANYQNQLDRNPRV
FRLAGNNPQGGFGGPQQQQPQQNILNGFDPQVIAQALKIDVRLAQELQNKQDSRGNIVRV
KGPFQVVRPPLRQAYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPN
LGRVTSVNSYTIPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDN
GQNVLDQQVQKGQLVVIPQGFAYVVQSQNNFEWISFKTNANAMISTLAGRTSALRALPLE
VITNAFQISLEEARKIKFNTLETTLTRARGGQQPQLIEEIVEV
Parent Accession