Powered by FoodRisk.org

Allergen

AAX93750.1

Accession AAX93750.1
Species Crocus sativus
Common Name Saffron crocus
Description Ole e 1-like protein
IUIS Name Cro s 1
Gi
Length 168
Year Adopted 2021
Sequence >AAX93750.1 Allergen Cro s 1; Ole e 1-like protein [Crocus sativus]
MGKCQAVFLLVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQ
FMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPV
HGDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGE
ASDIRSANALGFMRKEPLKECPEVLKELDLYDVKAN
Parent Accession