Powered by FoodRisk.org

Allergen

AAY83345.1

Accession AAY83345.1
Species Fragaria x ananassa
Common Name Strawberry
Description lipid transfer protein (LTP) type 1
IUIS Name Fra a 3
Gi 0067937773
Length 117
Year Adopted 2015
Sequence >AAY83345.1 Allergen Fra a 3; lipid transfer protein (LTP) type 1 [Fragaria x ananassa]
MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSL
NSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK
Parent Accession