Allergen

AAZ76743.1

Accession AAZ76743.1
Species Penaeus aztecus
Common Name Brown shrimp
Description Pen a 1 allergen
IUIS Name
Gi 0073532979
Length 284
Year Adopted 2007
Sequence >AAZ76743.1 Pen a 1 allergen [Penaeus aztecus]
MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV
QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Parent Accession