Powered by FoodRisk.org

Allergen

ABB89296.1

Accession ABB89296.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 6.0101 [Blattella germanica]
Gi 0082704032
Length 151
Year Adopted 2008
Sequence >accession|ABB89296.1|Putative allergen Bla g 6.0101 [Blattella germanica]
MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGS
GELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKIT
AEDLDMMIEEIDSDGSGTVDFDEFMEVMTGE