Powered by FoodRisk.org

Allergen

ABB89298.1

Accession ABB89298.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 6.0301 [Blattella germanica]
Gi 0082704036
Length 154
Year Adopted 2008
Sequence >accession|ABB89298.1|Putative allergen Bla g 6.0301 [Blattella germanica]
MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD
ADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD
EQLTSDELDMMIEEIDADGSGTVDFDEFMEMMTG