Powered by FoodRisk.org

Allergen

ABC18306.1

Accession ABC18306.1
Species Fagopyrum esculentum
Common Name Buckwheat
Description 16 kDa allergen [Fagopyrum esculentum]
Gi 0083416591
Length 149
Year Adopted 2007
Sequence >accession|ABC18306.1|Putative 16 kDa allergen [Fagopyrum esculentum]
MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI
LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK
EGVRDLKELPSKCGLSELECGSRGNRYFV