Allergen

ABF81661.1

Accession ABF81661.1
Species Zea mays
Common Name Corn
Description EXPB10 [Zea mays]
IUIS Name
Gi 0105969543
Length 99
Year Adopted 2008
Sequence >ABF81661.1 Putative EXPB10 [Zea mays]
CKYGSKVTFHLEKGCNPNYLALLVKYVDGDGDIVAVDIKEKGSDTYEPLKHSWGAIWRKD
SDKPIKGPITVRLTTEGGTKTVYDDVIPAEWKPNTAYTT
Parent Accession