Allergen

ABF81662.1

Accession ABF81662.1
Species Zea mays
Common Name Corn
Description EXPB10 [Zea mays]
IUIS Name
Gi 0105969545
Length 269
Year Adopted 2008
Sequence >ABF81662.1 Putative EXPB10 [Zea mays]
MTVVSIMWSLVQVQVLVAVALSFLVGGAWCGPPKVPPGKNITANYGSDWLDAKATWYGKP
TGAGPDDNGGGCGYKDVNKAPFNSMGACGNVPIFKDGLGCGSCFEIKCDKPAECSGKPVV
VYITDMNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYGSKVTFHL
EKGCNPNYLALLVKYVDGDGDIVAVDIKEKGSDTYEPLKHSWGAIWRKDSDKPIKGPITV
RLTTEGGTKTVYDDVIPTDWKPNTAYTTK
Parent Accession