Powered by FoodRisk.org

Allergen

ABG76185.1

Accession ABG76185.1
Species Blomia tropicalis
Common Name Storage mite
Description group 2 allergen
IUIS Name Blo t 2
Gi
Length 142
Year Adopted 2021
Sequence >ABG76185.1 Allergen Blo t 2; group 2 allergen [Blomia tropicalis]
MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKS
FTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKG
QKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVD
Parent Accession