Allergen

ABG81289.1

Accession ABG81289.1
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description profilin
IUIS Name Phl p 12
Length 131
Year Adopted 2008
Sequence >ABG81289.1 Phl p 12; profilin [Phleum pratense]
MSWQAYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL
APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVKQGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
8123000 Valenta,R.; Ball,T.; Vrtala,S.; Duchene,M.; Kraft,D.; Scheiner,O. cDNA cloning and expression of timothy grass (Phleum pratense) pollen profilin in Escherichia coli: comparison with birch pollen profilin Biochem. Biophys. Res. Commun. 199 (1), 106-118 (1994)
15286445 Rossi RE; Monasterolo G Evaluation of recombinant and native timothy pollen (rPhl p 1, 2, 5, 6, 7, 11, 12 and nPhl p 4)- specific IgG4 antibodies induced by subcutaneous immunotherapy with timothy pollen extract in allergic patients. Int Arch Allergy Immunol. 2004 Sep;135(1):44-53
12534548 Mari A Skin test with a timothy grass (Phleum pratense) pollen extract vs. IgE to a timothy extract vs. IgE to rPhl p 1, rPhl p 2, nPhl p 4, rPhl p 5, rPhl p 6, rPhl p 7, rPhl p 11, and rPhl p 12: epidemiological and diagnostic data. Clin Exp Allergy. 2003 Jan;33(1):43-51