Allergen

ABG81313.1

Accession ABG81313.1
Species Zea mays
Common Name Corn
Description pollen profilin variant 2 [Zea mays]
IUIS Name
Gi 0110644954
Length 131
Year Adopted 2008
Sequence >ABG81313.1 Putative pollen profilin variant 2 [Zea mays]
MSWQAYVDEHLMCEIEGHHLTSAAIVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVE
RLGDYLLEQGL
Parent Accession